Cyclin E1 Recombinant monoclonal antibody, PBS Only

Cyclin E1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 82700-10-PBS
Clone No.240136D4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), ELISA

CCNE1, G1/S-specific cyclin-E1, G1/S specific cyclin E1, Cyclin E, CCNE

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82700-10-PBS targets Cyclin E1 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2110

Product name: Recombinant human Cyclin E protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 111-410 aa of BC035498

Sequence: ANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

Predict reactive species
Full Name cyclin E1
Calculated Molecular Weight 410 aa, 47 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC035498
Gene Symbol Cyclin E1
Gene ID (NCBI) 898
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP24864
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cyclin E1 (CCNE1) is a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNE1, an essential cyclin activating Cdk2, regulates the G1-S phase transition of the mammalian cell division cycle. Its timing expression plays a direct role in the initiation of DNA replication , the control of histone biosynthesis, and the centrosome cycle. CCNE1 is associated with disease progression in various malignancies and is associated clinically with poor prognosis. Two bands of Cyclin E1 were expressed in U2OS and MDA-MB-231 cells (PMID:9858585, PMID: 24112607).

Loading...
||
New chat Able
正在加载,请稍候...