Cyclin E2 Recombinant monoclonal antibody, PBS Only

Cyclin E2 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85803-3-PBS
Clone No.243114A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

CCNE2, CYCE2, Cyclin E, G1/S specific cyclin E2, G1/S-specific cyclin-E2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85803-3-PBS targets Cyclin E2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2532

Product name: Recombinant human CCNE2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-374 aa of BC020729

Sequence: MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLCMISSHV

Predict reactive species
Full Name cyclin E2
Calculated Molecular Weight 374 aa, 44 kDa
Observed Molecular Weight 44 kDa
GenBank Accession NumberBC020729
Gene Symbol CCNE2
Gene ID (NCBI) 9134
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO96020
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cyclin E2 (CCNE2) belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of cyclindependent kinases (CDKs). Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of cell cycle events. CCNE2 forms a complex with and functions as a regulatory subunit of CDK2 and has been shown to specifically interact with CIP/KIP family of CDK inhibitors. CCNE2 plays a role in cell cycle G1/S transition and its expression peaks at the G1-S phase. Whereas cyclin E1 is expressed in most proliferating normal and tumor cells, cyclin E2 levels are low or undetectable in nontransformed cells, and are elevated in tumor-derived cells.

Loading...
||
New chat

Able

正在加载,请稍候...