Cyclophilin A Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Cyclophilin A Recombinant monoclonal antibody (86709-1-RR)

Cyclophilin A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86709-1-RR

Clone No.251706B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PPIA, Cyclosporin A binding protein, Cyclosporin A-binding protein, CYPA, CYPH

• 

  WB analysis using 86709-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86709-1-RR (Cyclophilin A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86709-1-RR targets Cyclophilin A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1120

  Product name: Recombinant human CYPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC005320

  Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

• Full Name: peptidylprolyl isomerase A (cyclophilin A)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC005320
• Gene Symbol: PPIA
• Gene ID (NCBI): 5478
• RRID: AB_3745070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62937
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.