• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Cystatin B Polyclonal antibody

Cystatin B Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10823

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

CSTB, CPI B, CPI-B, CST6, Cystatin-B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10823 targets Cystatin B in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1262

Product name: Recombinant human CSTB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-98 aa of BC003370

Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Predict reactive species
Full Name cystatin B (stefin B)
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC003370
Gene Symbol Cystatin B
Gene ID (NCBI) 1476
RRIDAB_3672467
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen Affinity Purified
UNIPROT IDP04080
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cystatin B (CSTB), a member of the cystatin superfamily protein, is a stefin that functions as an intracellular thiol protease inhibitor and has been thought to play a role in protecting against the proteases leaking from lysosomes. CSTB plays various functions in a variety of diseases, including epithelial ovarian cancer, colon cancer, and myoclonus epilepsy. Evidence indicates that mutations in CSTB are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Cystatin B antibody CL488-10823Download protocol
IF protocol for CL Plus 488 Cystatin B antibody CL488-10823Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...