Cystatin F Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Cystatin F Recombinant monoclonal antibody (87771-1-RR)

• 

  WB analysis using 87771-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87771-1-RR (Cystatin F antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

Cystatin F Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87771-1-RR

Clone No.253239D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CST7, CST 7, Cystatin 7, Cystatin-7, Cystatin-F

---

Tested Applications

• Positive WB detected in: U-937 cells, Hela cells (negative), K-562 cells (negative), THP-1 cells (negative)

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87771-1-RR targets Cystatin F in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg8049

  Product name: Recombinant human Cystatin F protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 20-145 aa of BC015507

  Sequence: GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

• Full Name: cystatin F (leukocystatin)
• Calculated Molecular Weight: 167 aa, 19 kDa
• Observed Molecular Weight: 16-25 kDa
• GenBank Accession Number: BC015507
• Gene Symbol: Cystatin F
• Gene ID (NCBI): 8530
• RRID: AB_3745745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O76096
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cystatin F (also known as CST7, CMAP or leucocyte cystatin) is an endogenous cysteine protease inhibitor belonging to type II cystatin superfamily. Covalently linked homodimer is formed through C26-C63 disulfide bonds, which is the main form of its secretion. It contains N- glycosylation sites (Asn62 and Asn115), and glycosylation modification determines its intracellular localization-high mannose type guides it to target lysosomes, and complex sugar chain type promotes secretion. The active form is monomer, and the dimer needs to be activated in lysosomal reduction environment, and the 15 amino acids at the N-terminal are removed by cathepsin V to become a completely active form. Mainly expressed in peripheral blood cells (such as cytotoxic lymphocytes, eosinophils, neutrophils, mast cells) and spleen.