Cytokeratin 5 Monoclonal antibody

Cytokeratin 5 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66727-1-Ig
Clone No.1A1C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

CK 5, CK-5, keratin 5, KRT5, 1A1C5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHaCaT cells, SKOV-3 cells, mouse skin tissue, MCF-7 cells, A549 cells, A-253 cells, A431 cells, human saliva, pig skin tissue
Positive IHC detected inhuman tonsillitis tissue, human breast cancer tissue, human breast hyperplasia tissue, human cervical cancer tissue, human lung cancer tissue, human oesophagus cancer tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman oesophagus cancer tissue, human prostate cancer tissue, human lung cancer tissue
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66727-1-Ig targets Cytokeratin 5 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24184

Product name: Recombinant human KRT5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 316-491 aa of BC024292

Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI

Predict reactive species
Full Name keratin 5
Calculated Molecular Weight 590 aa, 62 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC024292
Gene Symbol Cytokeratin 5
Gene ID (NCBI) 3852
RRIDAB_2882077
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP13647
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD keratin 14 in stratified squamous epithelia. Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD tyK14 in stratified squamous epithelia.

Protocols

Product Specific Protocols
IF protocol for Cytokeratin 5 antibody 66727-1-IgDownload protocol
IHC protocol for Cytokeratin 5 antibody 66727-1-IgDownload protocol
WB protocol for Cytokeratin 5 antibody 66727-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC,IF

Nat Genet

Spatially resolved transcriptomic analysis of the adult human prostate

Authors - Junyi Hu
ratIF

Cell Mol Biol Lett

The role of NPY2R/NFATc1/DYRK1A regulatory axis in sebaceous glands for sebum synthesis

Authors - Tao Yang
mouseIHC

Front Genet

The Unique Genetic and Histological Characteristics of DMBA-Induced Mammary Tumors in an Organoid-Based Carcinogenesis Model.

Authors - Mie Naruse
humanWB

PLoS One

Construction of ceRNA network to identify the lncRNA and mRNA related to non-small cell lung cancer.

Authors - Kui Xiao
humanWB

Cell Death Dis

SOX1 promotes differentiation of nasopharyngeal carcinoma cells by activating retinoid metabolic pathway.

Authors - Xin-Xing Lei
mouse,humanIHC

Regen Ther

Promotion of skin wound healing using hypoimmunogenic epidermal cell sheets

Authors - Hongqing Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sonam (Verified Customer) (03-10-2026)

Worked well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: cancer cells
FH

Emma (Verified Customer) (11-29-2021)

Used by IF on FFPE prostate tissue. Tris-EFTA antigen retrieval.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Prostate
Cytokeratin 5 Antibody Immunofluorescence validation (1:100 dilution) in Prostate (Cat no:66727-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...