CoraLite®594-conjugated Cytokeratin 5 Monoclonal antibody

Cytokeratin 5 Monoclonal Antibody for IF-P

Cat No. CL594-66727
Clone No.1A1C5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig

Applications

IF-P

58 kDa cytokeratin, CK 5, CK5, Cytokeratin 5, Cytoskeleton Marker, K5, keratin 5, KRT5, KRT5A, Type II keratin Kb5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman oesophagus cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66727 targets Cytokeratin 5 in IF-P applications and shows reactivity with Human, mouse, pig samples.

Tested Reactivity Human, mouse, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24184

Product name: Recombinant human KRT5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 316-491 aa of BC024292

Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI

Predict reactive species
Full Name keratin 5
Calculated Molecular Weight 590 aa, 62 kDa
GenBank Accession NumberBC024292
Gene Symbol Cytokeratin 5
Gene ID (NCBI) 3852
RRIDAB_2920028
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP13647
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD keratin 14 in stratified squamous epithelia. Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD tyK14 in stratified squamous epithelia.

Protocols

Product Specific Protocols
IF protocol for CL594 Cytokeratin 5 antibody CL594-66727Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...