CoraLite® Plus 488-conjugated Cytokeratin 5 Monoclonal antibody

• 

  IF Staining of human oesophagus cancer using CL488-66727

  Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using CoraLite® Plus 488 Cytokeratin 5 antibody (CL488-66727, Clone: 1A1C5 ) at dilution of 1:200.

• 

  IF Staining of human oesophagus cancer using CL488-66727

  Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using CoraLite® Plus 488 Cytokeratin 5 antibody (CL488-66727, Clone: 1A1C5 ) at dilution of 1:200.

Cytokeratin 5 Monoclonal Antibody for IF-P

Cat No. CL488-66727

Clone No.1A1C5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig

Applications

IF-P

Synonyms

58 kDa cytokeratin, Cell and organelle markers, CK 5, CK5, Cytokeratin 5, Cytoskeleton Marker, K5, keratin 5, KRT5, KRT5A, Type II keratin Kb5

---

Tested Applications

• Positive IF-P detected in: human oesophagus cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66727 targets Cytokeratin 5 in IF-P applications and shows reactivity with Human, mouse, pig samples.

• Tested Reactivity: Human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24184

  Product name: Recombinant human KRT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 316-491 aa of BC024292

  Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI

• Full Name: keratin 5
• Calculated Molecular Weight: 590 aa, 62 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC024292
• Gene Symbol: Cytokeratin 5
• Gene ID (NCBI): 3852
• RRID: AB_2919361
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13647
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD keratin 14 in stratified squamous epithelia. Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD tyK14 in stratified squamous epithelia.