DAB1 Polyclonal antibody

DAB1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 31459-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Disabled homolog 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig cerebellum tissue, MCF-7 cells
Positive IHC detected inmouse cerebellum tissue, mouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31459-1-AP targets DAB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag35376

Product name: Recombinant human DAB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 132-280 aa of NM_021080

Sequence: KEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE

Predict reactive species
Full Name disabled homolog 1 (Drosophila)
Calculated Molecular Weight64 kDa
Observed Molecular Weight45 kDa, 80 kDa
GenBank Accession NumberNM_021080
Gene Symbol DAB1
Gene ID (NCBI) 1600
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDO75553
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Disabled-1 (Dab1) is an adaptor protein that is essential for neuronal migration and maturation in response to the extracellular protein Reelin. DAB1 protein docks to the intracellular part of the Reelin very low density lipoprotein receptor and apoE receptor type 2 and becomes tyrosine-phosphorylated following binding of Reelin to cortical neurons. The DAB1 protein contains a 180-amino acid N-terminal protein interaction/phosphotyrosine-binding (PTB) 1 domain that docks to the short cytoplasmic tail of the very low density lipoprotein receptor or apoE receptor type 2 at the level of NPXY motifs, with a preference for unphosphorylated motifs. Dab1 polypeptide bands ranging from 36 to 120 kDa have been identified in mouse embryonic brain, the 80-kDa Dab1 being the predominant form (PMID: 24313315).

Protocols

Product Specific Protocols
IF protocol for DAB1 antibody 31459-1-APDownload protocol
IHC protocol for DAB1 antibody 31459-1-APDownload protocol
WB protocol for DAB1 antibody 31459-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...