DAB1 Polyclonal antibody

• 

  WB analysis using 31459-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31459-1-AP (DAB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31459-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31459-1-AP (DAB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 31459-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 31459-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 31459-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 31459-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 31459-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DAB1 antibody (31459-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

DAB1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31459-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Disabled homolog 1

---

Tested Applications

• Positive WB detected in: pig cerebellum tissue, MCF-7 cells
• Positive IHC detected in: mouse cerebellum tissue, mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31459-1-AP targets DAB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35376

  Product name: Recombinant human DAB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-280 aa of NM_021080

  Sequence: KEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE

• Full Name: disabled homolog 1 (Drosophila)
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 45 kDa, 80 kDa
• GenBank Accession Number: NM_021080
• Gene Symbol: DAB1
• Gene ID (NCBI): 1600
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75553
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Disabled-1 (Dab1) is an adaptor protein that is essential for neuronal migration and maturation in response to the extracellular protein Reelin. DAB1 protein docks to the intracellular part of the Reelin very low density lipoprotein receptor and apoE receptor type 2 and becomes tyrosine-phosphorylated following binding of Reelin to cortical neurons. The DAB1 protein contains a 180-amino acid N-terminal protein interaction/phosphotyrosine-binding (PTB) 1 domain that docks to the short cytoplasmic tail of the very low density lipoprotein receptor or apoE receptor type 2 at the level of NPXY motifs, with a preference for unphosphorylated motifs. Dab1 polypeptide bands ranging from 36 to 120 kDa have been identified in mouse embryonic brain, the 80-kDa Dab1 being the predominant form (PMID: 24313315).