DACH2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DACH2 Polyclonal antibody, PBS Only (25219-1-PBS)

• 

  WB analysis using 25219-1-AP (same clone as 25219-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25219-1-AP (DACH2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25219-1-PBS in a different storage buffer formulation.

DACH2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25219-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Dachshund homolog 2

---

Product Information

25219-1-PBS targets DACH2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18403

  Product name: Recombinant human DACH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-181 aa of BC114950

  Sequence: KRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLP

• Full Name: dachshund homolog 2 (Drosophila)
• Calculated Molecular Weight: 599 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC114950
• Gene Symbol: DACH2
• Gene ID (NCBI): 117154
• RRID: AB_2879967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NX9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dachshund homolog 2 (DACH2), is a 599 amino acid protein, which belongs to the DACH family. DACH2 localizes in the nucleus and as a transcription factor is involved in regulation of organogenesis.