DAK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DAK Polyclonal antibody (12224-1-AP)

• Featured Product
• KD/KO Validated

DAK Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12224-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

FAD-AMP lyase, DHA kinase, cyclizing, cyclic FMN forming, Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase

• 

  WB analysis of HeLa using 12224-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12224-1-AP (DAK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12224-1-AP

  WB result of DAK antibody (12224-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-DAK transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12224-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12224-1-AP (DAK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12224-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12224-1-AP (DAK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse uterus using 12224-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 12224-1-AP (DAK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12224-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12224-1-AP (DAK Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 12224-1-AP

  IP result of anti-DAK (IP:12224-1-AP, 3ug; Detection:12224-1-AP 1:500) with HeLa cells lysate 2150ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 12224-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 12224-1-AP (DAK antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse uterus tissue, HepG2 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12224-1-AP targets DAK in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2861

  Product name: Recombinant human DAK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 226-576 aa of BC001341

  Sequence: VRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALVGTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEAPDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLKEGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAILEVLQS

• Full Name: dihydroxyacetone kinase 2 homolog (S. cerevisiae)
• Calculated Molecular Weight: 575 aa, 59 kDa
• Observed Molecular Weight: 55-59 kDa
• GenBank Accession Number: BC001341
• Gene Symbol: DAK
• Gene ID (NCBI): 26007
• RRID: AB_2277108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3LXA3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DAK, also name as TKFC, Triokinase, and FMN cyclase, catalyzes both the phosphorylation of dihydroxyacetone and of glyceraldehyde, and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate. DAK has some isoforms with MW 51-55 kDa and 59 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Endocrinology; Hepatic but not intestinal FBP1 is required for fructose metabolism and tolerance; Authors - Qiufang Bai
rat	WB	Mol Psychiatry; Proteasome-independent K63 polyubiquitination selectively regulates ATP levels and proteasome activity during fear memory formation in the female amygdala; Authors - Kayla Farrell
human	WB	Pharmaceuticals (Basel); Magnolol Inhibits High Fructose-Induced Podocyte Inflammation via Downregulation of TKFC/Sp1/HDAC4/Notch1 Activation; Authors - Ziang Zhou
human	WB,IF	iScience; CircSOBP suppresses the progression of glioma by disrupting glycolysis and promoting the MDA5-mediated immune response; Authors - Maolin Mu ; KO Validated
mouse	WB	Cell Metab; Circulating glycerate predicts resilience to fructose-induced hepatic steatosis; Authors - Cuauhtemoc B Ramirez
		Adv Sci (Weinh); TPI1 Loss Triggers a Metabolite-Driven Mitochondrial Redox Vulnerability via the SARM1-cADPR-Ca(2+) Axis.; Authors - Chunyu Liu