DAP1 Polyclonal antibody

• 

DAP1 Polyclonal Antibody for ELISA

Cat No. 10160-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

DAP, DAP 1, DAP1, death associated protein, Death associated protein 1

---

Product Information

10160-1-AP targets DAP1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0181

  Product name: Recombinant human DAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC002726

  Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK

• Full Name: death-associated protein
• Calculated Molecular Weight: 16 kDa
• GenBank Accession Number: BC002726
• Gene Symbol: DAP1
• Gene ID (NCBI): 1611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51397
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.