DAP13/NDUFA12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DAP13/NDUFA12 Polyclonal antibody, PBS Only (15793-1-PBS)

• 

  WB analysis using 15793-1-AP (same clone as 15793-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15793-1-AP (DAP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15793-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15793-1-AP (same clone as 15793-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15793-1-AP (DAP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 15793-1-AP (same clone as 15793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15793-1-AP (DAP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 15793-1-AP (same clone as 15793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15793-1-AP (DAP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15793-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15793-1-AP (same clone as 15793-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 15793-1-AP (DAP13 antibody), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15793-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DAP13/NDUFA12 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15793-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15793-1-PBS targets DAP13/NDUFA12 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8501

  Product name: Recombinant human NDUFA12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC005936

  Sequence: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12
• Calculated Molecular Weight: 17 kDa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005936
• Gene Symbol: DAP13/NDUFA12
• Gene ID (NCBI): 55967
• RRID: AB_2150475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI09
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.