DAPK3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DAPK3 Polyclonal antibody, PBS Only (30656-1-PBS)

• 

  WB analysis using 30656-1-AP (same clone as 30656-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30656-1-AP (DAPK3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30656-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 30656-1-AP (same clone as 30656-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30656-1-AP (DAPK3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30656-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30656-1-AP (same clone as 30656-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DAPK3 antibody (30656-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 30656-1-PBS in a different storage buffer formulation.

DAPK3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30656-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ZIP kinase, DAP kinase 3, DAP like kinase, DAP-like kinase, Death-associated protein kinase 3

---

Product Information

30656-1-PBS targets DAPK3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33051

  Product name: Recombinant human DAPK3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 252-361 aa of NM_001348

  Sequence: IRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYE

• Full Name: death-associated protein kinase 3
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 37, 52 kDa
• GenBank Accession Number: NM_001348
• Gene Symbol: DAPK3
• Gene ID (NCBI): 1613
• RRID: AB_3086381
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43293
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DAPK3, also named as ZIPK and Dlk, belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family and DAP kinase subfamily. The calculated molecular weight of DAPK3 is 52 kDa. This antibody can recognize the 37 kDa isoform of target. ZIP kinase is a Serine/threonine kinase which acts as a positive regulator of apoptosis. ZIP kinasephosphorylates histone H3 on 'Thr-11' at centromeres during mitosis. ZIP kinase regulates myosin light chain phosphatase through phosphorylation of MYPT1 thereby regulating the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. It catalyze the reaction: ATP + a protein = ADP + a phosphoprotein.