DARS2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DARS2 Polyclonal antibody (13807-1-AP)

• Featured Product
• KD/KO Validated

DARS2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13807-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

LBSL, EC:6.1.1.12, AspRS, Aspartyl-tRNA synthetase, Aspartate--tRNA ligase, mitochondrial

• 

  WB analysis using 13807-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13807-1-AP (DARS2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 13807-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13807-1-AP (DARS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 13807-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13807-1-AP (DARS2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 13807-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13807-1-AP (DARS2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 13807-1-AP (DARS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 13807-1-AP (DARS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 13807-1-AP (DARS2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 13807-1-AP (DARS2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13807-1-AP (DARS2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13807-1-AP (DARS2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13807-1-AP (DARS2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 13807-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13807-1-AP (DARS2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 13807-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DARS2 antibody (13807-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DARS2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, human placenta tissue, U-937 cells
• Positive IHC detected in: mouse cerebellum tissue, human brain tissue, human testis tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13807-1-AP targets DARS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4809

  Product name: Recombinant human DARS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 296-645 aa of BC045173

  Sequence: LIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH

• Full Name: aspartyl-tRNA synthetase 2, mitochondrial
• Calculated Molecular Weight: 645 aa, 74 kDa
• Observed Molecular Weight: 66-74 kDa
• GenBank Accession Number: BC045173
• Gene Symbol: DARS2
• Gene ID (NCBI): 55157
• RRID: AB_2088759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PI48
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DARS2 is also named as AspRS (aspartyl-tRNA synthetase) and belongs to the class-II aminoacyl-tRNA synthetase family. The deduced 645-amino acid protein has a 47-amino acid mitochondrial targeting signal, resulting in a mature protein of 598 amino acids. DARS2 contains conserved residues involved in ATP binding, tRNA binding, and aspartic acid recognition, as well as catalytic site motifs characteristic of amino acid tRNA synthetases. It is a dimeric proteins(PMID:19443655). Rat aspartyl-tRNA synthetase has a N-terminal polypeptide extension of about 40 amino acid residues which can be removed without impairing its catalytic activity(PMID:9030747). This protein has different molecular mass(55 kDa, 50 kDa,66 kDa ) according to the publications(PMID:11306575; 19443655;15299749).

Publications

What published studies show

The DARS2 Polyclonal antibody (Cat# 13807-1-AP) has 17 citations published in journals including Nature, Cell Metabolism, Nature Communications, EMBO Reports, Annals of Neurology, International Journal of Biological Sciences, Journal of Translational Medicine, and others. Research fields span mitochondrial metabolism and dysfunction, lung adenocarcinoma, bladder cancer, hepatocellular carcinoma, cardiac disease, immune signaling, gene therapy for leukoencephalopathy, intestinal homeostasis, obesity, and mitochondrial disease diagnosis.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Nature; Mitochondrial dysfunction abrogates dietary lipid processing in enterocytes; Authors - Chrysanthi Moschandrea ; KO Validated
mouse	WB	Cell Metab; Tissue-Specific Loss of DARS2 Activates Stress Responses Independently of Respiratory Chain Deficiency in the Heart.; Authors - Sukru Anil Dogan
mouse	WB	Cell Metab; Mitochondrial metabolism coordinates stage-specific repair processes in macrophages during wound healing.; Authors - Sebastian Willenborg
human	WB	Nat Commun; Targeted degradation of extracellular mitochondrial aspartyl-tRNA synthetase modulates immune responses; Authors - Benjamin S Johnson
human,mouse	WB,IHC	Int J Biol Sci; DARS2 Promotes Bladder Cancer Progression by Enhancing PINK1-Mediated Mitophagy; Authors - Dongqing Li ; KD Validated
human	IHC	J Transl Med; DARS2 overexpression is associated with PET/CT metabolic parameters and affects glycolytic activity in lung adenocarcinoma; Authors - Xu-Sheng Liu