Dopamine Transporter/DAT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Dopamine Transporter/DAT Polyclonal antibody, PBS Only (22524-1-PBS)

• 

  WB analysis using 22524-1-AP (same clone as 22524-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22524-1-AP (DAT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22524-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 22524-1-AP (same clone as 22524-1-PBS)

  IP result of anti-Dopamine Transporter/DAT (IP:22524-1-AP, 4ug; Detection:22524-1-AP 1:1000) with mouse brain tissue lysate 1720 ug. This data was developed using the same antibody clone with 22524-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22524-1-AP (same clone as 22524-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22524-1-AP (DAT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22524-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22524-1-AP (same clone as 22524-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22524-1-AP (DAT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22524-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22524-1-AP (same clone as 22524-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22524-1-AP (DAT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22524-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 22524-1-AP (same clone as 22524-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using DAT antibody (22524-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22524-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 22524-1-AP (same clone as 22524-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using Dopamine Transporter/DAT antibody (22524-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 22524-1-PBS in a different storage buffer formulation.

Dopamine Transporter/DAT Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

Cat No. 22524-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

Synonyms

2, SLC6A3, DA transporter, DAT, DAT1

---

Product Information

22524-1-PBS targets Dopamine Transporter/DAT in WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18297

  Product name: Recombinant human SLC6A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-62 aa of BC133003

  Sequence: MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET

• Full Name: solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
• Calculated Molecular Weight: 620 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC133003
• Gene Symbol: DAT
• Gene ID (NCBI): 6531
• RRID: AB_2879116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01959
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DAT, also name as SLC6A3, is dopamine transporter which is a member of the sodium- and chloride- dependent neurotransmitter transporter family. Dopamine(DA) released from neurons is cleared by the DA transporter (DAT). Altered dopaminergic signaling is linked to multiple neuropsychiatric disorders, such as attention deficit hyperactive disorder, mood disorders, schizophrenia, autism and so on (PMID:30755521). 22524-1-AP can detect 70~80kDa band, which is consistent with the report (PMID:12746456).