DAZAP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DAZAP2 Polyclonal antibody, PBS Only (15210-1-PBS)

• 

  WB analysis using 15210-1-AP (same clone as 15210-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15210-1-AP (DAZAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15210-1-PBS in a different storage buffer formulation.

DAZAP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15210-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

PRTB, Proline-rich transcript in brain protein, KIAA0058, Deleted in azoospermia-associated protein 2, DAZ-associated protein 2

---

Product Information

15210-1-PBS targets DAZAP2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7364

  Product name: Recombinant human DAZAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of BC002334

  Sequence: MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW

• Full Name: DAZ associated protein 2
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa, 22 kDa
• GenBank Accession Number: BC002334
• Gene Symbol: DAZAP2
• Gene ID (NCBI): 9802
• RRID: AB_3741860
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15038
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DAZAP2, also named KIAA0058, has six isoforms. In unstressed cells, it promotes SIAH1-mediated polyubiquitination and degradation of the serine/threonine-protein kinase HIPK2, probably by acting as a loading factor that potentiates complex formation between HIPK2 and ubiquitin ligase SIAH1. In response to DNA damage, it localizes to the nucleus following phosphorylation by HIPK2 and modulates the expression of a subset of TP53/p53 target genes by binding to TP53 at target gene promoters (PMID: 33591310).