DBF4 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 13076-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 13076-1-AP (DBF4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 13076-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 13076-1-AP (DBF4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

DBF4 Polyclonal Antibody for WB, ELISA

Cat No. 13076-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Activator of S phase kinase, ASK, CHIF, Chiffon homolog A, DBF4, DBF4 homolog (S. cerevisiae), DBF4A, Protein DBF4 homolog A, ZDBF1

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, Jurkat cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13076-1-AP targets DBF4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3771

  Product name: Recombinant human DBF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-333 aa of BC036045

  Sequence: MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPHPSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIEQKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSK

• Full Name: DBF4 homolog (S. cerevisiae)
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC036045
• Gene Symbol: DBF4
• Gene ID (NCBI): 10926
• RRID: AB_10638788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBU7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.