DBT Polyclonal antibody

• 

  WB analysis using 12451-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12451-1-AP (DBT antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12451-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12451-1-AP (DBT antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 12451-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12451-1-AP (DBT antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 12451-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12451-1-AP (DBT antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12451-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DBT antibody (12451-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

DBT Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12451-1-AP

Publications(10)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BCKDHE2, BCKAD-E2, BCKADE2, BCATE2, 52 kDa mitochondrial autoantigen of primary biliary cirrhosis

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse brain tissue, rat brain tissue, NCI-H1299 cells
• Positive IHC detected in: human stomach cancer tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1500-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

12451-1-AP targets DBT in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3101

  Product name: Recombinant human DBT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC016675

  Sequence: MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQG

• Full Name: dihydrolipoamide branched chain transacylase E2
• Calculated Molecular Weight: 482 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC016675
• Gene Symbol: DBT
• Gene ID (NCBI): 1629
• RRID: AB_2089636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11182
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Metab; Branched-chain amino acid catabolism in muscle affects systemic BCAA levels but not insulin resistance; Authors - Megan C Blair
mouse	WB,IP	J Nutr; Pyruvate Kinase M2 Supports Muscle Progenitor Cell Proliferation but Is Dispensable for Skeletal Muscle Regeneration after Injury.; Authors - Jamie E Blum
human,mouse	WB	Heliyon; Hyperactivation of mTOR and AKT in a cardiac hypertrophy animal model of Friedreich ataxia; Authors - Wing-Hang Tong
mouse	WB	Cell Metab; Extra-cardiac BCAA catabolism lowers blood pressure and protects from heart failure; Authors - Danielle Murashige
human	WB	Front Immunol; Overexpression of DBT suppresses the aggressiveness of renal clear cell carcinoma and correlates with immune infiltration; Authors - Chiyu Zhang
mouse	WB	J Thromb Haemost; Branched-chain amino acids promote thrombocytopoiesis by activating mTOR signaling; Authors - Haojie Jiang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Maria (Verified Customer) (08-15-2021)

DBT in human primary fibroblasts. 10 ug of total protein. 4-15% TGX gel. Blocking 3% BSA in PBST (0.1% Tween). 1:1000 primary ab O/N incubation at 4ºC. 1:5000 secondary ab HRP conj. 1h RT in BSA 3% in PBST.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human primary fibroblasts

DBT Antibody Western Blot validation (1:1000 dilution) in Human primary fibroblasts (Cat no:12451-1-AP)