DBX1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DBX1 Polyclonal antibody, PBS Only (33935-1-PBS)

• 

  WB analysis using 33935-1-AP (same clone as 33935-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33935-1-AP (DBX1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33935-1-PBS in a different storage buffer formulation.

DBX1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33935-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Developing brain homeobox protein 1, Homeobox protein DBX1

---

Product Information

33935-1-PBS targets DBX1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40954

  Product name: Recombinant human DBX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-343 aa of NM_001029865

  Sequence: ERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS

• Full Name: developing brain homeobox 1
• Calculated Molecular Weight: 343aa, 37 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: NM_001029865
• Gene Symbol: DBX1
• Gene ID (NCBI): 120237
• RRID: AB_3743117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NMT0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DBX1 (Homeobox protein DBX1) is a central nervous system (CNS)-specific transcription factor that plays crucial roles in embryonic brain development. It belongs to the H2.0 homeobox family and contains a DNA-binding homeodomain, which allows it to regulate gene expression by binding to specific DNA sequences.