DCBLD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCBLD1 Polyclonal antibody, PBS Only (24504-1-PBS)

• 

  IHC staining of mouse lung using 24504-1-AP (same clone as 24504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24504-1-AP (DCBLD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 24504-1-AP (same clone as 24504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24504-1-AP (DCBLD1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24504-1-PBS in a different storage buffer formulation.

DCBLD1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24504-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Discoidin, CUB and LCCL domain-containing protein 1

---

Product Information

24504-1-PBS targets DCBLD1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21352

  Product name: Recombinant human DCBLD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 240-317 aa of BC035671

  Sequence: DGSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESGDQVHWSPGQARLQDQGPSWASGDSSNNHKPREWLEID

• Full Name: discoidin, CUB and LCCL domain containing 1
• Calculated Molecular Weight: 715 aa, 78 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC035671
• Gene Symbol: DCBLD1
• Gene ID (NCBI): 285761
• RRID: AB_3085737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8Z6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCBLD1, a transmembrane protein with extracellular CUB (an extracellular domain of approximately 110 residues that is found in functionally diverse, mostly developmentally regulated proteins), LCCL (including 94-97 amino acids, non-cytoplasmic but the function is undefined), and F5/8 type C domains 8, is a type I transmembrane protein (A-D) that binds to semaphorins, belonging to the DCBLD family, and is rarely studied and poorly characterized.