Home
Products
Primary Antibodies
DCD Polyclonal antibody, PBS Only (11985-1-PBS)

Filter: AllIHC

IHC staining of human skin using 11985-1-AP (same clone as 11985-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 11985-1-AP (DCD Antibody) at dilution of 1:800 (under 10x lens). This data was developed using the same antibody clone with 11985-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 11985-1-AP (same clone as 11985-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 11985-1-AP (DCD Antibody) at dilution of 1:800 (under 40x lens). This data was developed using the same antibody clone with 11985-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11985-1-AP (same clone as 11985-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11985-1-AP (DCD Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11985-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11985-1-AP (same clone as 11985-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11985-1-AP (DCD Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11985-1-PBS in a different storage buffer formulation.

DCD Polyclonal antibody, PBS Only

Name: DCD Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11985-1-PBS

DCD Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 11985-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11985-1-PBS targets DCD in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2613 Product name: Recombinant human DCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC062682 Sequence: MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL Predict reactive species
Full Name	dermcidin
Calculated Molecular Weight	11 kDa
GenBank Accession Number	BC062682
Gene Symbol	DCD
Gene ID (NCBI)	117159
RRID	AB_2877812
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P81605
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Dermcidin, also named as DCD, AIDD and DSEP, is human antibiotic peptide secreted by sweat glands. It displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization.