DCHS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCHS2 Polyclonal antibody, PBS Only (31631-1-PBS)

• 

  WB analysis using 31631-1-AP (same clone as 31631-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31631-1-AP (DCHS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31631-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31631-1-AP (same clone as 31631-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31631-1-AP (DCHS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31631-1-PBS in a different storage buffer formulation.

DCHS2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31631-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Cadherin 27, Cadherin like protein CDHJ, Cadherin like protein VR8, CDH27, CDHJ

---

Product Information

31631-1-PBS targets DCHS2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35080

  Product name: Recombinant human DCHS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2500-2600 aa of NM_001358235

  Sequence: IFTISPVLLLDTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHV

• Full Name: dachsous 2 (Drosophila)
• Calculated Molecular Weight: 370 kDa
• Observed Molecular Weight: ~75 kDa
• GenBank Accession Number: NM_001358235
• Gene Symbol: DCHS2
• Gene ID (NCBI): 54798
• RRID: AB_3742458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6V1P9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCHS2 is a calcium-dependent cell adhesion molecule belonging to the cadherin superfamily. It plays an important role in cell-cell adhesion, tissue morphogenesis, and signal transduction, especially in forming cell polarity and tissue structure during development.