DCLK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCLK2 Polyclonal antibody, PBS Only (25450-1-PBS)

• 

  WB analysis using 25450-1-AP (same clone as 25450-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25450-1-AP (DCLK2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25450-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 25450-1-AP (same clone as 25450-1-PBS)

  IP result of anti-DCLK2 (IP:25450-1-AP, 4ug; Detection:25450-1-AP 1:3000) with mouse brain tissue lysate 2100 ug. This data was developed using the same antibody clone with 25450-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 25450-1-AP (same clone as 25450-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DCLK2 antibody (25450-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 25450-1-PBS in a different storage buffer formulation.

DCLK2 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 25450-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

DCAMKL2, CLICK-II, CLICK2, CLICK II, CL2

---

Product Information

25450-1-PBS targets DCLK2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22142

  Product name: Recombinant human DCLK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-71 aa of BC032726

  Sequence: MLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMFDLTV

• Full Name: doublecortin-like kinase 2
• Calculated Molecular Weight: 766 aa, 84 kDa
• Observed Molecular Weight: 83 kDa
• GenBank Accession Number: BC032726
• Gene Symbol: DCLK2
• Gene ID (NCBI): 166614
• RRID: AB_3085796
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N568
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCLK2 belongs to the protein kinase superfamily, contains two N-terminal doublecortin domains, a C-terminal serine/threonine protein kinase domain, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains. DCLK2 is expressed in the brain, heart and eyes (PMID: 18075264).