DCP1A Monoclonal antibody, PBS Only

• 

  WB analysis using 60494-1-Ig (same clone as 60494-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60494-1-Ig (DCP1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60494-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 60494-1-Ig (same clone as 60494-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60494-1-Ig (DCP1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60494-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 60494-1-Ig (same clone as 60494-1-PBS)

  WB result of DCP1A antibody (60494-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DCP1A transfected HEK-293 cells. This data was developed using the same antibody clone with 60494-1-PBS in a different storage buffer formulation.

DCP1A Monoclonal Antibody for WB, Indirect ELISA

Cat No. 60494-1-PBS

Clone No.2D11E2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

2D11E2, EC:3.6.1.62, HSA275986, mRNA decapping enzyme 1A, mRNA-decapping enzyme 1A

---

Product Information

60494-1-PBS targets DCP1A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18706

  Product name: Recombinant human DCP1A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC007439

  Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR

• Full Name: DCP1 decapping enzyme homolog A (S. cerevisiae)
• Calculated Molecular Weight: 582 aa, 63 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC007439
• Gene Symbol: DCP1A
• Gene ID (NCBI): 55802
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPI6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCP1 decapping enzyme homolog A (S. cerevisiae), known as mRNA-decapping enzyme 1A (DCP1A),is necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1. This antibody specifically react with the 70kd DCP1A protein.