DCP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DCP2 Polyclonal antibody (17744-1-AP)

DCP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17744-1-AP Copied!

Publications (4)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Nudix motif 20, Nucleoside diphosphate-linked moiety X motif 20, mRNA-decapping enzyme 2, m7GpppN-mRNA hydrolase, hDpc

• 

  WB analysis using 17744-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17744-1-AP (DCP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17744-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 17744-1-AP (DCP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 17744-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 17744-1-AP (DCP2 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DCP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, Caco-2 cells, T-47D cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17744-1-AP targets DCP2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12001

  Product name: Recombinant human DCP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-385 aa of BC064593

  Sequence: METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL

• Full Name: DCP2 decapping enzyme homolog (S. cerevisiae)
• Calculated Molecular Weight: 385aa,44 kDa; 420aa,48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC064593
• Gene Symbol: DCP2
• Gene ID (NCBI): 167227
• RRID: AB_3085538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IU60
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Able is busy answering your previous question. Please try again later.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Mol Cell; A dual-module ECAS complex couples transcription elongation and RNA processing.; Authors - Ying Xiang
	WB	Sci Rep; mRNA decapping enzyme2 DCP2 expression correlates with progression and prognosis of hepatocellular carcinoma; Authors - Tianyi Huang
		Bio Protoc; Quantitative Determination of Primary Cilia Protein Distribution Using Immunofluorescence Staining and MATLAB Analysis.; Authors - Andrew D Jenks
		Genes Dev; Multiple quality control checkpoints safeguard small nuclear RNA biogenesis and prevent assembly of aberrant spliceosomes.; Authors - Tiantai Ma

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is highly positive, with a 5-star rating. The reviewer used the antibody for Western Blot at a 1:1000 dilution on HEK293 cells and described the result as "great." Overall, the feedback indicates strong performance in WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Aditya (Verified Customer) (01-31-2025)

Looks great

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: hek293