DCPS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCPS Polyclonal antibody, PBS Only (28465-1-PBS)

• 

  WB analysis using 28465-1-AP (same clone as 28465-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28465-1-AP (DCPS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28465-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28465-1-AP (same clone as 28465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28465-1-AP (DCPS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28465-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 28465-1-AP (same clone as 28465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28465-1-AP (DCPS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28465-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 28465-1-AP (same clone as 28465-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DCPS antibody (28465-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 28465-1-PBS in a different storage buffer formulation.

DCPS Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28465-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DCS 1, DCS1, DCS-1, decapping enzyme, scavenger, Decapping scavenger enzyme

---

Product Information

28465-1-PBS targets DCPS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29351

  Product name: Recombinant human DCPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-160 aa of BC014532

  Sequence: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRN

• Full Name: decapping enzyme, scavenger
• Calculated Molecular Weight: 337 aa, 39 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC014532
• Gene Symbol: DCPS
• Gene ID (NCBI): 28960
• RRID: AB_3086054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96C86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DcpS, which is a member of the histidine triad (HIT) superfamily of pyrophosphatases, is the first HIT protein with a defined biological function and identifies the HIT motif as a new mRNA decapping domain. DcpS can encode a 38-40 kDa protein, and has the potential to form a homodimer of 80 kDa(PMID: 12198172).