DCTN3 Polyclonal antibody

• 

  WB analysis using 11325-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11325-1-AP (DCTN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

DCTN3 Polyclonal Antibody for WB, ELISA

Cat No. 11325-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DCTN 22, DCTN 3, DCTN22, dynactin 3 (p22), p22

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, MG-63 cells, U2OS cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11325-1-AP targets DCTN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1865

  Product name: Recombinant human DCTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC000319

  Sequence: MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

• Full Name: dynactin 3 (p22)
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC000319
• Gene Symbol: DCTN3
• Gene ID (NCBI): 11258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75935
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCTN3 (Dynactin Subunit 3, also known as p22) is a core component of the dynactin complex, essential for cytoplasmic dynein-mediated intracellular transport. This 22-kDa polypeptide binds directly to microtubules and stabilizes the dynactin structure, facilitating cargo movement along microtubule tracks. DCTN3 plays critical roles in mitotic spindle organization, vesicle trafficking, and neuronal development (PMID: 24352458).