DCTN3 Polyclonal antibody

• 

DCTN3 Polyclonal Antibody for ELISA

Cat No. 11325-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

DCTN 22, DCTN22, DCTN3, dynactin 3 (p22), Dynactin subunit 3, p22

---

Product Information

11325-1-AP targets DCTN3 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1865

  Product name: Recombinant human DCTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC000319

  Sequence: MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

• Full Name: dynactin 3 (p22)
• Calculated Molecular Weight: 186 aa, 21 kDa
• GenBank Accession Number: BC000319
• Gene Symbol: DCTN3
• Gene ID (NCBI): 11258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75935
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.