DCUN1D1 Polyclonal antibody

• 

  WB analysis using 10965-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10965-1-AP (DCUN1D1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 10965-1-AP

  WB result of DCUN1D1 antibody (10965-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DCUN1D1 transfected Jurkat cells.

• 

  IHC staining of human gliomas using 10965-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10965-1-AP (DCUN1D1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 10965-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10965-1-AP (DCUN1D1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

DCUN1D1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10965-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DCN1, DCN1 like protein 1, DCN1-like protein 1, DCNL1, DCUN 1D1

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

10965-1-AP targets DCUN1D1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1440

  Product name: Recombinant human DCUN1D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC009478

  Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

• Full Name: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC009478
• Gene Symbol: DCUN1D1
• Gene ID (NCBI): 54165
• RRID: AB_2088355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GG9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

It has been found that DCUN1D1, also known as squamous cell carcinoma-related oncogene, expression may play a role in development of brain metastasis in patients with Non-small cell lung carcinoma (NSCLC). DCUN1D1-positive tumor cells may have the ability to disrupt the blood-brain-barrier and colonize the brain. Those results suggest that DCUN1D1 may play a role in the brain parenchyma invasion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC	Biochem Cell Biol; Evaluation of HZX-960, a novel DCN1-UBC12 interaction inhibitor, as a potential antifibrotic compound for liver fibrosis.; Authors - Wenjuan Zhou ; KD Validated
mouse	WB	Nature; A male germ-cell-specific ribosome controls male fertility; Authors - Huiling Li
human,mouse	WB,IHC	Clin Sci (Lond); Blockade of neddylation through targeted inhibition of DCN1 alleviates renal fibrosis; Authors - Jin-Ling Huo ; KD Validated