DCUN1D1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DCUN1D1 Polyclonal antibody (10965-1-AP)

• Featured Product
• KD/KO Validated

DCUN1D1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10965-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

DCN1, DCN1 like protein 1, DCN1-like protein 1, DCNL1, DCUN 1D1

• 

  WB analysis using 10965-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10965-1-AP (DCUN1D1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 10965-1-AP

  WB result of DCUN1D1 antibody (10965-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DCUN1D1 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 10965-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10965-1-AP (DCUN1D1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 10965-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10965-1-AP (DCUN1D1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DCUN1D1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10965-1-AP targets DCUN1D1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1440

  Product name: Recombinant human DCUN1D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC009478

  Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

• Full Name: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC009478
• Gene Symbol: DCUN1D1
• Gene ID (NCBI): 54165
• RRID: AB_2088355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GG9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

It has been found that DCUN1D1, also known as squamous cell carcinoma-related oncogene, expression may play a role in development of brain metastasis in patients with Non-small cell lung carcinoma (NSCLC). DCUN1D1-positive tumor cells may have the ability to disrupt the blood-brain-barrier and colonize the brain. Those results suggest that DCUN1D1 may play a role in the brain parenchyma invasion.

Publications

What published studies show

Anti-DCN1 (10965-1-AP) has 6 published citations across Nature, Pharmacological Research, Clinical Science, FASEB Journal, Biochemistry & Cell Biology, and Research in Veterinary Science. Research fields include male germ-cell biology, cancer therapy via NEDD8 conjugation inhibition, renal fibrosis, vitiligo immunology, liver fibrosis, and goat pregnancy proteomics. Applications span WB and IHC in human, mouse, and goat samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; A male germ-cell-specific ribosome controls male fertility; Authors - Huiling Li
human	WB	Pharmacol Res; Orlistat targets NEDD8 conjugating enzyme UBC12 for cancer therapy.; Authors - Mengzhen Shen
human,mouse	WB,IHC	Clin Sci (Lond); Blockade of neddylation through targeted inhibition of DCN1 alleviates renal fibrosis; Authors - Jin-Ling Huo ; KD Validated
human	WB	FASEB J; Parkin-Mediated Ubiquitination of DCUN1D1: Implications for CXCL10 Regulation in Vitiligo.; Authors - Shiyu Jin
mouse,human	WB,IHC	Biochem Cell Biol; Evaluation of HZX-960, a novel DCN1-UBC12 interaction inhibitor, as a potential antifibrotic compound for liver fibrosis.; Authors - Wenjuan Zhou ; KD Validated
goat	WB	Res Vet Sci; DIA-based serum proteomics in goat pregnancy: biomarkers & mechanisms.; Authors - Dongliang Xu