DCUN1D5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DCUN1D5 Polyclonal antibody (14810-1-AP)

• Featured Product
• KD/KO Validated

DCUN1D5 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 14810-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DCN1-like protein 5, DCNL5, DCUN1 domain-containing protein 5, Defective in cullin neddylation protein 1-like protein 5, SCCRO5

• 

  WB analysis of HeLa using 14810-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14810-1-AP (DCUN1D5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14810-1-AP

  WB result of DCUN1D5 antibody (14810-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DCUN1D5 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14810-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14810-1-AP (DCUN1D5 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14810-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14810-1-AP (DCUN1D5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14810-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14810-1-AP (DCUN1D5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 14810-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 14810-1-AP (DCUN1D5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 14810-1-AP

  IP result of anti-DCUN1D5 (IP:14810-1-AP, 3ug; Detection:14810-1-AP 1:800) with HeLa cells lysate 1840ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14810-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 14810-1-AP (DCUN1D5 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DCUN1D5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, mouse testis tissue, U-937 cells, MDA-MB-231 cells, rat testis tissue
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14810-1-AP targets DCUN1D5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6534

  Product name: Recombinant human DCUN1D5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC004169

  Sequence: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS

• Full Name: DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC004169
• Gene Symbol: DCUN1D5
• Gene ID (NCBI): 84259
• RRID: AB_2088468
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTE7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Conjugation of Nedd8 to a cullin protein, termed neddylation, is an evolutionarily conserved process that functions to activate the cullin-RING family E3 ubiquitin ligases, leading to increased proteasomal degradation of a wide range of substrate proteins. Cellular neddylation requires the action of DCN1 (Defective in cullin neddylation protein 1), which, in humans, consists of five homologues designated as DCNL1-5. DCUN1D5 gene encodes the 28 kDa DCUN1 domain-containing protein 5 containing a C-terminal potentiating neddylation domain. The cellular function of DCUN1D5 needs to be explored, recently, a mono-ubiquitination-mediated mechanism that governs nuclear-cytoplasmic trafficking of hDCNL1, was reported to regulate hDCNL1-dependent activation of the cullin-RING E3 ubiquitin ligases in selected cellular compartments.

Publications

What published studies show

Anti-DCUN1D5 (Cat# 14810-1-AP) has 5 total citations published in Communications Biology, Biology Direct, Discover Oncology, Asian Pacific Journal of Cancer Prevention, and eLife. Research fields span cancer biology, including osteosarcoma immune remodeling and cisplatin resistance, triple-negative breast cancer progression, bladder cancer prognosis biomarkers, DNA damage response, and cullin-RING ubiquitin ligase function via the NEDD8 pathway.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Commun Biol; Single-cell analysis links DCUN1D5 to immune remodeling and cisplatin resistance in recurrent osteosarcoma; Authors - Xin Wu
human	WB,IHC	Biol Direct; YY1 mediated DCUN1D5 transcriptional activation promotes triple-negative breast cancer progression by targeting FN1/PI3K/AKT pathway; Authors - Yuxiang Lin
human	IHC	Discov Oncol; DCUN1D5 is a novel potential biomarker for predicting the prognosis of bladder cancer.; Authors - Xiaomin Han
human	WB,IHC	Asian Pac J Cancer Prev; In vitro biological characterization of DCUN1D5 in DNA damage response.; Authors - Guo Wei W
human	WB	Elife; SENP8 limits aberrant neddylation of NEDD8 pathway components to promote cullin-RING ubiquitin ligase function.; Authors - Kate E Coleman