DDB2 Polyclonal antibody

DDB2 Polyclonal Antibody for WB, ELISA
Cat No. 30173-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

WB, ELISA

DDB p48 subunit, DDB2, DDBB, DNA damage binding protein 2, FLJ34321, UV DDB 2, UV DDB2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, PC-12 cells, HCT 116 cells, HeLa cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, mouse kidney tissue, mouse liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30173-1-AP targets DDB2 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32811

Product name: Recombinant human DDB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 46-320 aa of NM_000107

Sequence: RRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQW

Predict reactive species
Full Name damage-specific DNA binding protein 2, 48kDa
Calculated Molecular Weight48 kDa
Observed Molecular Weight48-51 kDa
GenBank Accession NumberNM_000107
Gene Symbol DDB2
Gene ID (NCBI) 1643
RRIDAB_2935524
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92466
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDB2, also named as DNA damage-binding protein 2 or UV-damaged DNA-binding protein 2, is a 427 amino acid protein, which contains seven WD repeats and belongs to the WD repeat DDB2/WDR76 family. DDB2 is ubiquitously expressed, with highest levels in corneal endothelium and lowest levels in brain. DDB2 localizes in the nucleus and is required for DNA repair. DDB2 regulates negatively the constitutive expression of the SOD2 gene in breast cancer cells and exerts, at least in part, a control of breast cancer cell growth. DDB2 can play a role as oncogene and may become a promising candidate as a predictive marker in breast cancer.

Protocols

Product Specific Protocols
WB protocol for DDB2 antibody 30173-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...