Product Information
60965-1-PBS targets DDHD2 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18391 Product name: Recombinant human DDHD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 56-174 aa of BC010504 Sequence: MDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCTDRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPE Predict reactive species |
| Full Name | DDHD domain containing 2 |
| Calculated Molecular Weight | 711 aa, 81 kDa |
| GenBank Accession Number | BC010504 |
| Gene Symbol | DDHD2 |
| Gene ID (NCBI) | 23259 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O94830 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
