Use Able AI chat for product recommendations
  • Featured Product

DDOST Polyclonal antibody

DDOST Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit, KIAA0115, OK/SW cl.45, OK/SW-cl.45, OST48

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for DDOST in ?

Tested Applications

Positive WB detected inHeLa cells, A549 cells, mouse pancreas tissue, rat pancreas tissue
Positive IP detected inmouse pancreas tissue
Positive IHC detected inmouse testis tissue, human colon cancer tissue, rat colon tissue, rat kidney tissue, rat salivary gland tissue, human placenta tissue, rat small intestine tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14916-1-AP targets DDOST in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6727

Product name: Recombinant human DDOST protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 92-433 aa of BC002594

Sequence: FLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAF

Predict reactive species
Full Name dolichyl-diphosphooligosaccharide-protein glycosyltransferase
Calculated Molecular Weight 49 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC002594
Gene Symbol DDOST
Gene ID (NCBI) 1650
RRIDAB_2230534
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP39656
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDOST (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit), also known as OST48, is an integral membrane protein and a core component of the oligosaccharyltransferase (OST) complex located in the endoplasmic reticulum (ER). It plays a critical role in the transfer of pre-assembled oligosaccharide chains to asparagine residues of nascent polypeptides, a fundamental process known as N-linked protein glycosylation. Beyond its enzymatic function, DDOST contributes to protein folding quality control, endoplasmic reticulum-associated degradation (ERAD), and the unfolded protein response (UPR). Altered expression of DDOST has been implicated in cancer progression, metastasis, and chemoresistance.

Protocols

Product Specific Protocols
IHC protocol for DDOST antibody 14916-1-APDownload protocol
IP protocol for DDOST antibody 14916-1-APDownload protocol
WB protocol for DDOST antibody 14916-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DDOST polyclonal antibody (Cat# 14916-1-AP) has 13 citations spanning journals including Cell Metabolism, Nature Communications, Nature Chemical Biology, Advanced Science, mBio, iScience, and others. Research fields cover N-linked glycosylation, protein O-GlcNAcylation, heart failure, atherosclerotic calcification, viral infections (dengue, Zika), colorectal cancer metastasis, hepatocellular carcinoma, glioma, rheumatoid arthritis, gut microbiota, and pancreatic acinar metaplasia.

SpeciesApplicationTitle
mouseWB,CoIP

Cell Metab

Protein O-GlcNAcylation and hexokinase mitochondrial dissociation drive heart failure with preserved ejection fraction

Authors - Yuki Tatekoshi
mouse,humanWB,IHC,IF

Nat Commun

Smooth muscle NF90 deficiency ameliorates diabetic atherosclerotic calcification in male mice via FBXW7-AGER1-AGEs axis

Authors - Fei Xie
humanWB

Nat Chem Biol

Oligosaccharyltransferase inhibition induces senescence in RTK-driven tumor cells.

Authors - Cecilia Lopez-Sambrooks
humanWB

Adv Sci (Weinh)

N-glycosylation Modification of CTSD Affects Liver Metastases in Colorectal Cancer

Authors - Nan Xiong

Adv Sci (Weinh)

Inhibition of Aberrant Activated Fibroblast-Like Synoviocytes in Rheumatoid Arthritis by Leishmania Peptide via the Regulation of Fatty Acid Synthesis Metabolism

Authors - Jianling Su
mouseWB

J Agric Food Chem

Comparative Study of the Effects of Dietary-Free and -Bound Nε-Carboxymethyllysine on Gut Microbiota and Intestinal Barrier

Authors - Xiaojin Yuan

Reviews

    2.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Nicole S.) tested this antibody by Western Blot on HeLa cells at a 1:1000 dilution and rated it 2 out of 5. She reported no signal on nitrocellulose membranes and only a weak double band on PVDF, suggesting suboptimal performance in her hands.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Nicole (Verified Customer) (04-28-2022)

80µl RIPA Hela cell extract: Nitrocellulose: no signal PVDF: weak signal, double band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hela
Loading...
||
New chat

Able™

正在加载,请稍候...