Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, mouse pancreas tissue, rat pancreas tissue |
| Positive IP detected in | mouse pancreas tissue |
| Positive IHC detected in | mouse testis tissue, human colon cancer tissue, rat colon tissue, rat kidney tissue, rat salivary gland tissue, human placenta tissue, rat small intestine tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14916-1-AP targets DDOST in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6727 Product name: Recombinant human DDOST protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 92-433 aa of BC002594 Sequence: FLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAF Predict reactive species |
| Full Name | dolichyl-diphosphooligosaccharide-protein glycosyltransferase |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC002594 |
| Gene Symbol | DDOST |
| Gene ID (NCBI) | 1650 |
| RRID | AB_2230534 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P39656 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDOST (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit), also known as OST48, is an integral membrane protein and a core component of the oligosaccharyltransferase (OST) complex located in the endoplasmic reticulum (ER). It plays a critical role in the transfer of pre-assembled oligosaccharide chains to asparagine residues of nascent polypeptides, a fundamental process known as N-linked protein glycosylation. Beyond its enzymatic function, DDOST contributes to protein folding quality control, endoplasmic reticulum-associated degradation (ERAD), and the unfolded protein response (UPR). Altered expression of DDOST has been implicated in cancer progression, metastasis, and chemoresistance.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DDOST antibody 14916-1-AP | Download protocol |
| IP protocol for DDOST antibody 14916-1-AP | Download protocol |
| WB protocol for DDOST antibody 14916-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DDOST polyclonal antibody (Cat# 14916-1-AP) has 13 citations spanning journals including Cell Metabolism, Nature Communications, Nature Chemical Biology, Advanced Science, mBio, iScience, and others. Research fields cover N-linked glycosylation, protein O-GlcNAcylation, heart failure, atherosclerotic calcification, viral infections (dengue, Zika), colorectal cancer metastasis, hepatocellular carcinoma, glioma, rheumatoid arthritis, gut microbiota, and pancreatic acinar metaplasia.
| Species | Application | Title |
|---|---|---|
Cell Metab Protein O-GlcNAcylation and hexokinase mitochondrial dissociation drive heart failure with preserved ejection fraction | ||
Nat Commun Smooth muscle NF90 deficiency ameliorates diabetic atherosclerotic calcification in male mice via FBXW7-AGER1-AGEs axis | ||
Nat Chem Biol Oligosaccharyltransferase inhibition induces senescence in RTK-driven tumor cells. | ||
Adv Sci (Weinh) N-glycosylation Modification of CTSD Affects Liver Metastases in Colorectal Cancer | ||
Adv Sci (Weinh) Inhibition of Aberrant Activated Fibroblast-Like Synoviocytes in Rheumatoid Arthritis by Leishmania Peptide via the Regulation of Fatty Acid Synthesis Metabolism | ||
J Agric Food Chem Comparative Study of the Effects of Dietary-Free and -Bound Nε-Carboxymethyllysine on Gut Microbiota and Intestinal Barrier |
Reviews
What customers say
One reviewer (Nicole S.) tested this antibody by Western Blot on HeLa cells at a 1:1000 dilution and rated it 2 out of 5. She reported no signal on nitrocellulose membranes and only a weak double band on PVDF, suggesting suboptimal performance in her hands.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nicole (Verified Customer) (04-28-2022) | 80µl RIPA Hela cell extract: Nitrocellulose: no signal PVDF: weak signal, double band
|
