DDOST Polyclonal antibody

• 

  WB analysis using 14916-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14916-1-AP (DDOST antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14916-1-AP

  WB result of DDOST antibody (14916-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDOST transfected HeLa cells.

• 

  WB analysis of A549 using 14916-1-AP

  WB result of DDOST antibody (14916-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDOST transfected A549 cells.

• 

  IP experiment of mouse pancreas using 14916-1-AP

  IP result of anti-DDOST (IP:14916-1-AP, 4ug; Detection:14916-1-AP 1:1000) with mouse pancreas tissue lysate 3200 ug.

• 

  IHC staining of mouse testis using 14916-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 14916-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat small intestine using 14916-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of rat small intestine using 14916-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse pancreas using 14916-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of mouse pancreas using 14916-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

DDOST Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14916-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit, KIAA0115, OK/SW cl.45, OK/SW-cl.45, OST48

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, mouse pancreas tissue, rat pancreas tissue
• Positive IP detected in: mouse pancreas tissue
• Positive IHC detected in: mouse testis tissue, rat small intestine tissue, mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below
• IHC: See 3 publications below
• IF: See 1 publications below
• CoIP: See 2 publications below

Product Information

14916-1-AP targets DDOST in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6727

  Product name: Recombinant human DDOST protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 92-433 aa of BC002594

  Sequence: FLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAF

• Full Name: dolichyl-diphosphooligosaccharide-protein glycosyltransferase
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC002594
• Gene Symbol: DDOST
• Gene ID (NCBI): 1650
• RRID: AB_2230534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P39656
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,CoIP	Cell Metab; Protein O-GlcNAcylation and hexokinase mitochondrial dissociation drive heart failure with preserved ejection fraction; Authors - Yuki Tatekoshi
mouse,human	WB,IHC,IF	Nat Commun; Smooth muscle NF90 deficiency ameliorates diabetic atherosclerotic calcification in male mice via FBXW7-AGER1-AGEs axis; Authors - Fei Xie
human	WB	Nat Chem Biol; Oligosaccharyltransferase inhibition induces senescence in RTK-driven tumor cells.; Authors - Cecilia Lopez-Sambrooks
mouse	WB	J Agric Food Chem; Comparative Study of the Effects of Dietary-Free and -Bound Nε-Carboxymethyllysine on Gut Microbiota and Intestinal Barrier; Authors - Xiaojin Yuan
mouse	WB,CoIP	Res Sq; Hexokinase-1 mitochondrial dissociation and protein O-GlcNAcylation drive heart failure with preserved ejection fraction; Authors - Hossein Ardehali
human	IHC	IET Syst Biol; An immune-related multi-omics analysis of dolichyl-diphosphooligosaccharide protein glycosyltransferase in glioma: Prognostic value exploration and competitive endogenous RNA network identification; Authors - Jie Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Nicole (Verified Customer) (04-28-2022)

80µl RIPA Hela cell extract: Nitrocellulose: no signal PVDF: weak signal, double band

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Hela