DDT Polyclonal antibody

• 

  WB analysis of rat liver using 12389-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 12389-1-AP (DDT Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12389-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12389-1-AP (DDT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

DDT Polyclonal Antibody for WB, ELISA

Cat No. 12389-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

D dopachrome decarboxylase, D dopachrome tautomerase, DDCT, DDT, Phenylpyruvate tautomerase II

---

Tested Applications

• Positive WB detected in: rat liver tissue, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12389-1-AP targets DDT in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3065

  Product name: Recombinant human DDT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC015508

  Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

• Full Name: D-dopachrome tautomerase
• Calculated Molecular Weight: 118 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC015508
• Gene Symbol: DDT
• Gene ID (NCBI): 1652
• RRID: AB_2292859
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30046
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Pathol; Role of MIF1/MIF2/CD74 interactions in bladder cancer; Authors - Benjamin L Woolbright