Tested Applications
| Positive WB detected in | HEK-293 cells, A431 cells, HeLa cells, MCF-7 cells, NCI-H1299 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue, PC-3 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HEK-293 cells, PC-3 cells |
| Positive IHC detected in | human stomach tissue, human lymphoma tissue, human ovary tumor tissue, mouse brain tissue, mouse lung tissue, mouse skin tissue, rat brain tissue, rat lung tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11357-1-AP targets DDX1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1887 Product name: Recombinant human DDX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 391-740 aa of BC012132 Sequence: IPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 |
| Calculated Molecular Weight | 740 aa, 82 kDa |
| Observed Molecular Weight | 70-82 kDa |
| GenBank Accession Number | BC012132 |
| Gene Symbol | DDX1 |
| Gene ID (NCBI) | 1653 |
| RRID | AB_2092222 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92499 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDX1 is a DEAD box protein, which is putative RNA helicases with a characteristic asp-glu-ala-asp (DEAD) box motif. DEAD box proteins involve in translation initiation, splicing, and ribosome and spliceosome assembly by altering RNA secondary structure. As a RNA helicase, DDX1 has a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX1 antibody 11357-1-AP | Download protocol |
| IHC protocol for DDX1 antibody 11357-1-AP | Download protocol |
| IP protocol for DDX1 antibody 11357-1-AP | Download protocol |
| WB protocol for DDX1 antibody 11357-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-DDX1 antibody (Cat# 11357-1-AP) has accumulated 30 citations in high-impact journals including Cell, Nature Biotechnology, Molecular Cell, Immunity, Nature Communications, Nucleic Acids Research, Cell Host & Microbe, Developmental Cell, Cancer Science, and Journal of Molecular Biology. Associated research fields encompass RNA biology, virology, oncology, immunology, neuroscience, gene editing, and metabolic regulation.
| Species | Application | Title |
|---|---|---|
Nat Biotechnol The reverse transcriptase domain of prime editors contributes to DNA repair in mammalian cells | ||
Mol Cancer CircLONP2 enhances colorectal carcinoma invasion and metastasis through modulating the maturation and exosomal dissemination of microRNA-17. | ||
Immunity Virus-induced deconjugation of ISG15 dysregulates innate immunity and cellular metabolism. | ||
Cell Host Microbe RNase L Activates the NLRP3 Inflammasome during Viral Infections.
| ||
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application. The reviewer reported excellent performance using a 1:2000 dilution in 5% BSA, with clear results obtained via chemiluminescence on a ChemiDoc Imaging System. Overall, the feedback is positive, highlighting reliable signal and ease of use in standard WB workflows.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ilham (Verified Customer) (08-06-2024) | It works very well - the AB was diluted 1:2000 in 5% BSA -chemiluminescence blots using the ChemiDoc Imaging System.
|
