DDX18 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DDX18 Polyclonal antibody (28502-1-AP)

• 

  WB analysis using 28502-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28502-1-AP (DDX18 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293T using 28502-1-AP

  IP result of anti-DDX18 (IP:28502-1-AP, 4ug; Detection:28502-1-AP 1:1500) with HEK-293T cells lysate 1560 ug.

• 

  IF Staining of HEK-293 using 28502-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using DDX18 antibody (28502-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

DDX18 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 28502-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

DDX18, DEAD box protein 18, FLJ33908, MrDb, Myc regulated DEAD box protein

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, K-562 cells
• Positive IP detected in: HEK-293T cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

28502-1-AP targets DDX18 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27457

  Product name: Recombinant human DDX18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-165 aa of BC001238

  Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 80-85 kDa
• GenBank Accession Number: BC001238
• Gene Symbol: DDX18
• Gene ID (NCBI): 8886
• RRID: AB_2881158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVP1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	J Radiat Res; NOP58 modulates radiosensitivity in non-small cell lung cancer via DDX18-mediated DNA damage repair.; Authors - Yiqian Jiang
human	WB,CoIP	Adv Sci (Weinh); Ascites circRNA ASCOR Drives Platinum Resistance of High-Grade Serous Ovarian Cancer by Facilitating RPA1 Nuclear Translocation.; Authors - Hanyuan Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wael (Verified Customer) (12-08-2022)

Hek293 cells were fractionate into Nuclear and cytoplasmic fractions. DDX18 shows the expected Nuclear localization, just below the 100KD mark, as expected.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Hek293

DDX18 Antibody Western Blot validation (1:1000 dilution) in Hek293 (Cat no:28502-1-AP)