DDX18 Recombinant monoclonal antibody, PBS Only (Capture)

DDX18 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 85789-2-PBS
Clone No.250053A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

ATP-dependent RNA helicase DDX18, cPERP-D, DEAD box protein 18, EC:3.6.4.13, MrDb

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85789-2-PBS targets DDX18 as part of a matched antibody pair:

MP02107-2: 85789-2-PBS capture and 85789-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27457

Product name: Recombinant human DDX18 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 7-165 aa of BC001238

Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
Calculated Molecular Weight 75 kDa
Observed Molecular Weight80 kDa
GenBank Accession NumberBC001238
Gene Symbol DDX18
Gene ID (NCBI) 8886
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NVP1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DDX18 (DEAD-box helicase 18) is a protein belonging to the DEAD-box deconjugating enzyme family that is widely involved in RNA metabolism. It plays a key role in the assembly of the ribosomal small subunit (SSU) and ensures efficient intracellular protein synthesis. DDX18 unwinds RNA double strands through its deconjugating enzyme activity, which is essential for the proper processing and functional execution of RNA molecules. In addition, DDX18 is a multifunctional RNA deconjugating enzyme involved in a variety of signaling pathways, playing a key role not only in ribosome assembly and RNA metabolism, but also in the regulation of a variety of biological processes such as cell cycle, genome stability and stem cell pluripotency.

Loading...
||
New chat Able
正在加载,请稍候...