DDX24 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DDX24 Polyclonal antibody (15769-1-AP)

• Featured Product
• KD/KO Validated

DDX24 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15769-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, RIP, ELISA

Synonyms

EC:3.6.4.13, DDX 24, ATP-dependent RNA helicase DDX24

• 

  WB analysis using 15769-1-AP

  HT-29 cells were subjected to SDS PAGE followed by western blot with 15769-1-AP (DDX24 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15769-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15769-1-AP (DDX24 antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 15769-1-AP

  WB result of DDX24 antibody (15769-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX24 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15769-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15769-1-AP (DDX24 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15769-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DDX24 antibody (15769-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DDX24 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-29 cells, A549 cells, HeLa cells, THP-1 cells, Y79 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15769-1-AP targets DDX24 in WB, IHC, IF/ICC, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8407

  Product name: Recombinant human DDX24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 509-859 aa of BC008847

  Sequence: TLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPEQPQPSTSAN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 24
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC008847
• Gene Symbol: DDX24
• Gene ID (NCBI): 57062
• RRID: AB_2246003
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZR7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX24 is a family member of Asp-Glu-Ala-Asp (DEAD) box containing RNA helicases, and DEAD-box RNA helicases are characterized by a conserved DEAD motif. DDX24 was associated with cancer development, viral infection,and vascular malformation.

Publications

What published studies show

DDX24 Polyclonal antibody (Cat# 15769-1-AP) has 8 citations published in Molecular Cancer, Cancer Research, Molecular Cell, Theranostics, Advanced Science, Cell Reports, BMC Medical Genomics, and Archives of Oral Biology. Research fields span RNA m6A modification and chromatin architecture, hepatocellular carcinoma, viral infection, lung cancer autophagy, ovarian cancer splicing regulation, blood-brain barrier integrity, ferroptosis in sepsis, and inflammation in oral squamous cell carcinoma.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	CoIP	Mol Cancer; The METTL3-YTHDC1 axis mediates architectural RNA m(6)A modification to modulate the integrity of chromatin TADs in MLLr + AML genome.; Authors - Ruishuang Fu
human	WB,IHC,RIP	Cancer Res; RNA helicase DDX24 stabilizes LAMB1 to promote hepatocellular carcinoma progression.; Authors - Hong Shan ; KD Validated
human	IF	Mol Cell; 1The RNA helicase DDX39A binds a conserved structure in chikungunya virus RNA to control infection; Authors - Iulia Tapescu
human	WB	Theranostics; Loss of DDX24 inhibits lung cancer progression by stimulating IKBKG splicing-mediated autophagy; Authors - Siwen Sun ; KD Validated
human	WB	Adv Sci (Weinh); Disruption of the SNRPF-DDX24-E2F4 Feedback Loop Uncouples Splicing and Transcriptional Regulation to Suppress Ovarian Cancer Progression.; Authors - Yingwei Li ; KD Validated
human, mouse	WB	Cell Rep; DEAD-box helicase DDX24 is essential for endothelial mitochondrial function to maintain the blood-brain barrier.; Authors - Shuai Li ; KD Validated