DDX25 Polyclonal antibody

• 

  WB analysis of human testis using 14370-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 14370-1-AP (DDX25 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 14370-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14370-1-AP (DDX25 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

DDX25 Polyclonal Antibody for ELISA

Cat No. 14370-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

ELISA

Synonyms

DDX25, DEAD box protein 25, GRTH

---

Product Information

14370-1-AP targets DDX25 in ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5702

  Product name: Recombinant human DDX25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-370 aa of BC050360

  Sequence: MGFNRPSKIQEMALPMMLAHPPQNLIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNRIPRGTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFEDSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIEKIDY

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 25
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC050360
• Gene Symbol: DDX25
• Gene ID (NCBI): 29118
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHL0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.