• Featured Product
  • KD/KO Validated

DDX39A Polyclonal antibody

DDX39A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11723-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

DDX39, DEAD box protein 39, DDXL, BAT1L, BAT1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells
Positive IP detected inHEK-293 cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11723-1-AP targets DDX39A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2311

Product name: Recombinant human DDX39 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC032128

Sequence: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQPVTLSAVQGFPAADPGGHQSVWPGDGHRASQHRL

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 39
Calculated Molecular Weight 427 aa, 49 kDa
Observed Molecular Weight 49-55 kDa
GenBank Accession NumberBC032128
Gene Symbol DDX39
Gene ID (NCBI) 10212
RRIDAB_10858318
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00148
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX39A, also named the BAT1 protein, contains the nine conserved motifs that characterize the DEAD-box family of RNA-binding proteins. The family includes proteins found in all eukaryotic cell types, with considerable divergence in the sequences lying between the conserved motifs. Some of the motifs were known before the definition of the family and are responsible for binding to mRNA or ATP, or possess ATPase activity. Phylogenetic analyses have grouped BAT1 with the defining member of the DEAD-box family, eIF-4. This is a translation initiation factor required for the dissociation of stem/loop structures in mRNA at the ribosomes. This antibody may cross-react with DDX39B.

Protocols

Product Specific Protocols
WB protocol for DDX39A antibody 11723-1-APDownload protocol
IHC protocol for DDX39A antibody 11723-1-APDownload protocol
IF protocol for DDX39A antibody 11723-1-APDownload protocol
IP protocol for DDX39A antibody 11723-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nucleic Acids Res

A novel all-in-one conditional knockout system uncovered an essential role of DDX1 in ribosomal RNA processing.

Authors - Teruhiko Suzuki
humanWB,IHC

Int J Biol Sci

DDX39 as a predictor of clinical prognosis and immune checkpoint therapy efficacy in patients with clear cell renal cell carcinoma.

Authors - Yewei Bao
humanWB

Cell Rep

Proteomics reveal cap-dependent translation inhibitors remodel the translation machinery and translatome.

Authors - J J David Ho
human,chickenIF,WB

PLoS Pathog

TREX (transcription/export)-NP complex exerts a dual effect on regulating polymerase activity and replication of influenza A virus

Authors - Lingcai Zhao
  • KD Validated
humanIP,WB,IF

Mol Cell

1The RNA helicase DDX39A binds a conserved structure in chikungunya virus RNA to control infection

Authors - Iulia Tapescu
  • KD Validated
humanWB

J Transl Med

A novel peptide encoded by circSRCAP confers resistance to enzalutamide by inhibiting the ubiquitin-dependent degradation of AR-V7 in castration-resistant prostate cancer

Authors - Xiannan Meng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Robin (Verified Customer) (12-12-2019)

Great signal but specificity is questionable in comparison to UAP56 (ddx39B)

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: mouse fibroblasts
Loading...
||
New chat Able
正在加载,请稍候...