Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

DDX39A Recombinant monoclonal antibody, PBS Only

DDX39A Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83083-5-PBS
Clone No.230375F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

DDX39, 230375F9, ATP-dependent RNA helicase DDX39A, BAT1, BAT1L

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83083-5-PBS targets DDX39A in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2311

Product name: Recombinant human DDX39 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC032128

Sequence: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQPVTLSAVQGFPAADPGGHQSVWPGDGHRASQHRL

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 39
Calculated Molecular Weight 427 aa, 49 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC032128
Gene Symbol DDX39
Gene ID (NCBI) 10212
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00148
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DDX39A, also named the BAT1 protein, contains the nine conserved motifs that characterize the DEAD-box family of RNA-binding proteins. The family includes proteins found in all eukaryotic cell types, with considerable divergence in the sequences lying between the conserved motifs. Some of the motifs were known before the definition of the family and are responsible for binding to mRNA or ATP, or possess ATPase activity. Phylogenetic analyses have grouped BAT1 with the defining member of the DEAD-box family, eIF-4. This is a translation initiation factor required for the dissociation of stem/loop structures in mRNA at the ribosomes.

Loading...
||
New chat

Able

正在加载,请稍候...