DDX3Y Polyclonal antibody

• 

  WB analysis using 14041-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14041-1-AP (DDX3Y antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 14041-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14041-1-AP (DDX3Y antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 14041-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14041-1-AP (DDX3Y antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 14041-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14041-1-AP (DDX3Y antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 14041-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14041-1-AP (DDX3Y antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 14041-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DDX3Y antibody (14041-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

DDX3Y Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14041-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ATP-dependent RNA helicase DDX3Y, DBY, DEAD box protein 3, Y-chromosomal, EC:3.6.4.13

---

Tested Applications

• Positive WB detected in: DU 145 cells, LNCaP cells, PC-3 cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IP: See 1 publications below

Product Information

14041-1-AP targets DDX3Y in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5110

  Product name: Recombinant human DDX3Y protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 311-660 aa of BC034942

  Sequence: LERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDYRQSSGSSSSGFGASRGSSSRSGGGGYGNSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC034942
• Gene Symbol: DDX3Y
• Gene ID (NCBI): 8653
• RRID: AB_2092884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15523
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. DDX3Y is one member of DEAD box RNA helicases, encode by the gene locate on the chromosome Y in the azoospermia factor A region. Polyclonal anti-DDX3Y antibodies (14041-1-AP) are produced by immunizing animals with C-terminus of DDX3Y and detect an 73-kDa band. As DDX3Y has a structural homolog with DDX3X, the antibody can recognize both.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Acta Histochem; Antioncogenic roles of USP9Y and DDX3Y in lung cancer: USP9Y stabilizes DDX3Y by preventing its degradation through deubiquitination; Authors - Lei Xiu