DDX43 Monoclonal antibody, PBS Only

• 

  WB analysis using 68454-1-Ig (same clone as 68454-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68454-1-Ig (DDX43 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68454-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68454-1-Ig (same clone as 68454-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68454-1-Ig (DDX43 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68454-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68454-1-Ig (same clone as 68454-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68454-1-Ig (DDX43 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68454-1-PBS in a different storage buffer formulation.

DDX43 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68454-1-PBS

Clone No.1B3B2

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, Rabbit

Applications

WB, Indirect ELISA

Synonyms

Cancer/testis antigen 13, CT13, DDX43, DEAD box protein 43, DEAD box protein HAGE, DKFZp434H2114, HAGE, Helical antigen

---

Product Information

68454-1-PBS targets DDX43 in WB, Indirect ELISA applications and shows reactivity with Human, Rat, Rabbit samples.

• Tested Reactivity: Human, Rat, Rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11484

  Product name: Recombinant human DDX43 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 264-648 aa of BC066938

  Sequence: KPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKREMERKMERPQGRPKKFH

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
• Calculated Molecular Weight: 648 aa, 73 kDa
• Observed Molecular Weight: 68-73 kDa
• GenBank Accession Number: BC066938
• Gene Symbol: DDX43
• Gene ID (NCBI): 55510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NXZ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DDX43 (DEAD-box helicase 43), also known as HAGE (helicase antigen gene), is a member of the DEAD-box protein family. DDX43 is highly expressed in many tumors and is, therefore, considered a potential target for immunotherapy.