DDX46 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01807-1

  Sandwich ELISA standard curve of MP01807-1, Human DDX46 Recombinant Matched Antibody Pair - PBS only. 85065-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag10342. 85065-1-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL.

• 

  Sample test of MP01807-1

  The mean DDX46 concentration was determined to be 109.98 ng/mL in HEK-293 cell extract based on a 2.70 mg/mL extract load and 35.02 ng/mL in HeLa cell extract based on a 1.50 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01807-1

  Cytometric bead array standard curve of MP01807-1, DDX46 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85065-3-PBS. Detection antibody: 85065-1-PBS. Standard: Ag10342. Range: 0.781-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 85065-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 85065-1-PBS against Human DDX46 was performed. The affinity constant is below 1 pM.

DDX46 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85065-1-PBS

Clone No.242715C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

DEAD box protein 46, EC:3.6.4.13, KIAA0801, Probable ATP-dependent RNA helicase DDX46

---

Product Information

85065-1-PBS targets DDX46 as part of a matched antibody pair:

MP01807-1: 85065-3-PBS capture and 85065-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10342

  Product name: Recombinant human DDX46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 682-1031 aa of BC012304

  Sequence: GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
• Calculated Molecular Weight: 1031 aa, 117 kDa
• GenBank Accession Number: BC012304
• Gene Symbol: DDX46
• Gene ID (NCBI): 9879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7L014
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.