DDX5 Polyclonal antibody

• 

  WB analysis of HepG2 using 26385-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26385-1-AP (DDX5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 26385-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26385-1-AP (DDX5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 26385-1-AP

  IP result of anti-DDX5 (IP:26385-1-AP, 4ug; Detection:26385-1-AP 1:500) with HeLa cells lysate 1600 ug.

• 

  IHC staining of mouse liver using 26385-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26385-1-AP (DDX5 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 26385-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26385-1-AP (DDX5 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 26385-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 26385-1-AP (DDX5 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 26385-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 26385-1-AP (DDX5 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 26385-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDX5 antibody (26385-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

DDX5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 26385-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DDX5, DEAD box protein 5, G17P1, HELR, HLR1, HUMP68, p68, RNA helicase p68

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse liver tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26385-1-AP targets DDX5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24821

  Product name: Recombinant human DDX5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 434-614 aa of NM_004396

  Sequence: RSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 5
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: NM_004396
• Gene Symbol: DDX5
• Gene ID (NCBI): 1655
• RRID: AB_2880498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17844
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX5 or p68, a member of DEAD/H BOX, which has a characteristic DEAD box, is a proliferation-associated nuclear antigen. DDX5 involves in the alternative regulation of pre-mRNA splicing, act as a RNA helicase to increase tau exon10 inclusion in a RBM4-dependent manner. It's also a transcription coactivator for extrogen receptor ESR1 and androgen receptor AR. Once synergized with DDX17 and SRA1 RNA, DDX5 activated MYOD1 transcription activity and involved in skeletal muscle differentiation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Eur J Med Chem; Discovery of potent thiazolidin-4-one sulfone derivatives for inhibition of proliferation of osteosarcoma in vitro and in vivo; Authors - Xuwen Chen