Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, NIH/3T3 cells, THP-1 cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human colon tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25068-1-AP targets RIG-1/DDX58 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18585 Product name: Recombinant human DDX58 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 575-925 aa of BC132786 Sequence: RAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 |
| Calculated Molecular Weight | 925 aa, 106 kDa |
| Observed Molecular Weight | 101~106 kDa |
| GenBank Accession Number | BC132786 |
| Gene Symbol | RIG-1/DDX58 |
| Gene ID (NCBI) | 23586 |
| RRID | AB_2879881 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95786 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDX58, also named as RIG-1, belongs to the helicase family. It is involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). It is essential for the production of interferons in response to RNA viruses including paramyxoviruses, influenza viruses, Japanese encephalitis virus and HCV.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RIG-1/DDX58 antibody 25068-1-AP | Download protocol |
| IP protocol for RIG-1/DDX58 antibody 25068-1-AP | Download protocol |
| WB protocol for RIG-1/DDX58 antibody 25068-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RIG-1/DDX58 Polyclonal antibody (Cat# 25068-1-AP) has 14 citations published in journals including Cell Death & Differentiation, PNAS, EMBO Molecular Medicine, PLoS Biology, Cancer Genetics, Biomolecules, Cancer Medicine, Neurology International, Veterinary Microbiology, Transboundary and Emerging Diseases, Virology, and bioRxiv. Research fields span innate immunity, antiviral signaling, cancer biology (ovarian, colorectal, breast, glioblastoma, nasopharyngeal), hematopoiesis, autophagy regulation, and virology.
| Species | Application | Title |
|---|---|---|
Cell Death Differ Targeting ADAR1 lactylation activates innate immune and overcomes chemoresistance in ovarian cancer. | ||
Cancer Genet Context-specific roles of DDX60 in colorectal cancer via autophagy regulation and DDX58 signaling. | ||
Proc Natl Acad Sci U S A IFIH1 (MDA5) is required for innate immune detection of intron-containing RNA expressed from the HIV-1 provirus | ||
EMBO Mol Med Betrixaban activates cGAS and ERVs to promote dual nucleic-sensing antiviral immunity.
| ||
PLoS Biol Impaired hematopoiesis and embryonic lethality at midgestation of mice lacking both lipid transfer proteins VPS13A and VPS13C. | ||
Biomolecules Targeting G9a Exerts Pleiotropic Suppression in Triple-Negative Breast Cancer Cells: Cooperatively Inducing Pyroptosis and Apoptosis. |
Reviews
What customers say
Both reviewers (5/5 stars) used this product for Western Blot at a 1:1000 dilution on HEK-293T cells and reported excellent results. One described it as "works very well" and the other as "highly recommended." Overall, the feedback is consistently positive with no reported issues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vikas (Verified Customer) (12-23-2024) | Used for WB, works very well.
|
RASHMI (Verified Customer) (11-27-2024) | Used for WB, Highly recommended
|
