Use Able AI chat for product recommendations

RIG-1/DDX58 Polyclonal antibody

RIG-1/DDX58 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IP, CoIP, ELISA

DDX58, RIG-I, Retinoic acid-inducible gene 1 protein, EC:3.6.4.13, DEAD box protein 58

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RIG-1/DDX58 in ?

Tested Applications

Positive WB detected inA431 cells, HeLa cells, NIH/3T3 cells, THP-1 cells
Positive IP detected inA431 cells
Positive IHC detected inhuman colon tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25068-1-AP targets RIG-1/DDX58 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, pig, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18585

Product name: Recombinant human DDX58 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 575-925 aa of BC132786

Sequence: RAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
Calculated Molecular Weight 925 aa, 106 kDa
Observed Molecular Weight 101~106 kDa
GenBank Accession NumberBC132786
Gene Symbol RIG-1/DDX58
Gene ID (NCBI) 23586
RRIDAB_2879881
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95786
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX58, also named as RIG-1, belongs to the helicase family. It is involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). It is essential for the production of interferons in response to RNA viruses including paramyxoviruses, influenza viruses, Japanese encephalitis virus and HCV.

Protocols

Product Specific Protocols
IHC protocol for RIG-1/DDX58 antibody 25068-1-APDownload protocol
IP protocol for RIG-1/DDX58 antibody 25068-1-APDownload protocol
WB protocol for RIG-1/DDX58 antibody 25068-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RIG-1/DDX58 Polyclonal antibody (Cat# 25068-1-AP) has 14 citations published in journals including Cell Death & Differentiation, PNAS, EMBO Molecular Medicine, PLoS Biology, Cancer Genetics, Biomolecules, Cancer Medicine, Neurology International, Veterinary Microbiology, Transboundary and Emerging Diseases, Virology, and bioRxiv. Research fields span innate immunity, antiviral signaling, cancer biology (ovarian, colorectal, breast, glioblastoma, nasopharyngeal), hematopoiesis, autophagy regulation, and virology.

SpeciesApplicationTitle
humanWB

Cell Death Differ

Targeting ADAR1 lactylation activates innate immune and overcomes chemoresistance in ovarian cancer.

Authors - Linlu Cui
humanCoIP

Cancer Genet

Context-specific roles of DDX60 in colorectal cancer via autophagy regulation and DDX58 signaling.

Authors - Kai Wang
humanWB,IP

Proc Natl Acad Sci U S A

IFIH1 (MDA5) is required for innate immune detection of intron-containing RNA expressed from the HIV-1 provirus

Authors - Mehmet Hakan Guney
human,mouseWB

EMBO Mol Med

Betrixaban activates cGAS and ERVs to promote dual nucleic-sensing antiviral immunity.

Authors - Xingyu Chen
  • KO Validated
mouse,humanWB

PLoS Biol

Impaired hematopoiesis and embryonic lethality at midgestation of mice lacking both lipid transfer proteins VPS13A and VPS13C.

Authors - Peng Xu
humanWB

Biomolecules

Targeting G9a Exerts Pleiotropic Suppression in Triple-Negative Breast Cancer Cells: Cooperatively Inducing Pyroptosis and Apoptosis.

Authors - Jialin Li

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers (5/5 stars) used this product for Western Blot at a 1:1000 dilution on HEK-293T cells and reported excellent results. One described it as "works very well" and the other as "highly recommended." Overall, the feedback is consistently positive with no reported issues.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Vikas (Verified Customer) (12-23-2024)

Used for WB, works very well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293T

RASHMI (Verified Customer) (11-27-2024)

Used for WB, Highly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293
Loading...
||
New chat

Able™

正在加载,请稍候...