Product Information
83286-2-PBS targets DDX60 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34626 Product name: Recombinant human DDX60 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1135-1250 aa of BC038115 Sequence: KLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKG Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 |
| Calculated Molecular Weight | 1712 aa, 198 kDa |
| GenBank Accession Number | BC038115 |
| Gene Symbol | DDX60 |
| Gene ID (NCBI) | 55601 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IY21 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
