DECR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DECR2 Polyclonal antibody (25855-1-AP)

DECR2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25855-1-AP Copied!

Publications (2)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

2,4 dienoyl CoA reductase 2, DECR2, PDCR, SDR17C1

• 

  WB analysis of mouse lung using 25855-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 25855-1-AP (DECR2 Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 25855-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 25855-1-AP (DECR2 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 25855-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25855-1-AP (DECR2 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 25855-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25855-1-AP (DECR2 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DECR2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25855-1-AP targets DECR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23052

  Product name: Recombinant human DECR2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-244 aa of BC011968

  Sequence: MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL

• Full Name: 2,4-dienoyl CoA reductase 2, peroxisomal
• Calculated Molecular Weight: 292 aa, 31 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC011968
• Gene Symbol: DECR2
• Gene ID (NCBI): 26063
• RRID: AB_2880270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUI1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DECR2 Polyclonal antibody (catalog 25855-1-AP) has 2 citations. They appear in the Journal of Cell Biology and bioRxiv. Both studies focus on cell biology, specifically how the p97 ATPase and its adaptor UBXD8 maintain peroxisome pools by suppressing pexophagy. The antibody was applied in Western blotting (WB) using human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Cell Biol; The p97 ATPase and its adaptor UBXD8 maintain peroxisome pools by preventing pexophagy.; Authors - Iris D. Montes
human	WB	bioRxiv; The p97-UBXD8 complex maintains peroxisome abundance by suppressing pexophagy; Authors - Iris D Montes

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is highly positive, with a 5-star rating. The user reported using a 1:1000 dilution on yeast post-nuclear supernatant for Western Blot and noted a clear signal with low background. Overall, the antibody performed well in their application, delivering reliable results.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Frauke (Verified Customer) (09-27-2021)

Clear signal, low background works on yeast postnuclear supernatant

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: yeast post nuclear supernatant