Product Information
33236-1-PBS targets DEFB119 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36816 Product name: Recombinant human DEFB119 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-84 aa of BC062212 Sequence: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP Predict reactive species |
| Full Name | defensin, beta 119 |
| Calculated Molecular Weight | 84 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC062212 |
| Gene Symbol | DEFB119 |
| Gene ID (NCBI) | 245932 |
| RRID | AB_3742909 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8N690 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
DEFB119 is a reproductive tract-specific β-defensin highly expressed in the testis and the epididymis (16). Single-cell sequencing analysis of testicular cells isolated from nonobstructive azoospermia men demonstrates an elevated expression of DEFB119 in the Sertoli cells. Male mice lacking the mouse ortholog DEFB19 demonstrated subfertility in both sexes. DEFB119 is also expressed in sperm and is involved in sperm chemotaxis. Elevated seminal DEFB119 was associated with a decrease in the observed genera, diversity and evenness of bacterial communities, and further distortion of the metacommunities (PMID: 39359400).
