DEFB121 Polyclonal antibody

• 

  IHC staining of human stomach cancer using 25761-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25761-1-AP (DEFB121 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 25761-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25761-1-AP (DEFB121 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 25761-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 25761-1-AP (DEFB121 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 25761-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 25761-1-AP (DEFB121 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 25761-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 25761-1-AP (DEFB121 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DEFB121 Polyclonal Antibody for IHC, ELISA

Cat No. 25761-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

DEFB-21, DEFB21, DEFB 21, Beta-defensin 21, Beta-defensin 121

---

Tested Applications

• Positive IHC detected in: human small intestine tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25761-1-AP targets DEFB121 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22712

  Product name: Recombinant human DEFB121 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-76 aa of BC130609

  Sequence: VTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV

• Full Name: defensin, beta 121
• Calculated Molecular Weight: 76 aa, 8 kDa
• GenBank Accession Number: BC130609
• Gene Symbol: DEFB121
• Gene ID (NCBI): 245934
• RRID: AB_2880228
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5J5C9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.